Recombinant Human MBD4 Protein Summary
| Description |
MBD4 (Human) GST-Tagged Recombinant Protein (Q01)
Source: Wheat Germ (in vitro) Amino Acid Sequence: KMAIPVLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSL |
| Preparation Method |
in vitro wheat germ expression system
|
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
MBD4
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human MBD4 Protein
- EC 3.2.2.-
- G/T mismatch glycosylase
- G/U mismatch glycosylase
- MBD4
- MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics
- methyl-CpG binding domain protein 4
- methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase
- Methyl-CpG-binding endonuclease 1
- Methyl-CpG-binding protein MBD4
- Mismatch-specific DNA N-glycosylase
- putative methyl-CpG binding protein
Background
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene. [provided by RefSeq]
