Recombinant Human GSTA2 Protein Summary
| Description |
GSTA2 (Human) GST-Tagged Recombinant Protein (P01)
Source: Wheat Germ (in vitro) Amino Acid Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF |
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
GSTA2
|
Applications/Dilutions
| Application Notes |
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human GSTA2 Protein
- EC 2.5.1.18
- glutathione S-aralkyltransferase A2
- glutathione S-aryltransferase A2
- glutathione S-transferase 2
- glutathione S-transferase A2
- glutathione S-transferase alpha 2
- GST class-alpha member 2
- GST HA subunit 2
- GST, class alpha, 2
- GST2glutathione S-alkyltransferase A2
- GSTA2-2
- GST-gamma
- GTA2
- GTH2
- HA subunit 2
- liver GST2
- MGC10525
- S-(hydroxyalkyl)glutathione lyase A2
Background
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq]
