5-HT5A Antibody (10D3) Summary
| Immunogen |
HTR5A (NP_076917 223 a.a. – 282 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
|
| Specificity |
HTR5A – 5-hydroxytryptamine (serotonin) receptor 5A
|
| Isotype |
IgG1 Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
HTR5A
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for 5-HT5A Antibody (10D3)
- 5HT5A
- 5-HT5A
- 5-HT-5A
- 5-HT5A5-hydroxytryptamine receptor 5A
- 5-hydroxytryptamine (serotonin) receptor 5A
- HTR5A
- MGC138226,5-HT-5
- Serotonin receptor 5A
Background
The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization.
