Recombinant Human COX17 Protein Summary
| Description |
COX17 (Human) GST-Tagged Recombinant Protein (P01)
Source: Wheat Germ (in vitro) Amino Acid Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI |
| Preparation Method |
in vitro wheat germ expression system
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
COX17
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human COX17 Protein
- COX17 (yeast) homolog, cytochrome c oxidase assembly protein
- COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)
- cytochrome c oxidase assembly protein (S. cerevisiae)
- cytochrome c oxidase assembly protein (yeast)
- cytochrome c oxidase copper chaperone
- human homolog of yeast mitochondrial copper recruitment
- MGC104397
- MGC117386
Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq]
