Share this post on:

Product: Brevianamide F

Recombinant Human Clathrin Heavy Chain 1/CHC17 Protein Summary

Description
Clathrin Heavy Chain 1/CHC17 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLTC

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Clathrin Heavy Chain 1/CHC17 Protein

  • CHC
  • CHC17
  • Clathrin Heavy Chain 1
  • Clathrin heavy chain on chromosome 17
  • clathrin, heavy chain (Hc)
  • clathrin, heavy chain
  • clathrin, heavy polypeptide (Hc)
  • clathrin, heavy polypeptide-like 2
  • CLH17
  • CLH-17
  • CLTC
  • CLTCL2
  • Hc
  • KIAA0034

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrins central role in membrane sorting and selective transport within the cell.

PMID: 23880372

Share this post on:

Author: Potassium channel