Recombinant Human STARD3 Protein Summary
| Description |
STARD3 (Human) GST-Tagged Recombinant Protein (Q01)
Source: Wheat Germ (in vitro) Amino Acid Sequence: AKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA |
| Preparation Method |
in vitro wheat germ expression system
|
| Details of Functionality |
This protein is not active and should not be used for experiments requiring activity.
|
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
STARD3
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human STARD3 Protein
- CAB1
- es64
- Metastatic lymph node gene 64 protein
- metastatic lymph node protein 64
- MLN 64
- MLN64FLJ41370
- Protein CAB1
- StARD3
- StAR-related lipid transfer (START) domain containing 3
- stAR-related lipid transfer protein 3
- START domain containing 3
- START domain-containing protein 3
- steroidogenic acute regulatory protein related
Background
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD3 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM]
