NKX6.1 Antibody (1B7) Summary
| Immunogen |
NKX6-1 (NP_006159 191 a.a. – 275 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGM*
|
| Specificity |
NKX6-1 (1B7)
|
| Isotype |
IgG2a Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
NKX6-1
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NKX6.1 Antibody (1B7)
- Homeobox protein NK-6 homolog A
- NK homeo box, family 6, member A
- NK homeobox (Drosophila), family 6, A
- NK homeobox, family 6, A
- NK6 homeobox 1
- NK6 transcription factor homolog A
- NK6 transcription factor related, locus 1 (Drosophila)
- NK6 transcription factor related, locus 1
- NKX6.1
- NKX6-1
- NKX6A
- NKX6Ahomeobox protein Nkx-6.1
Background
In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM]
