Recombinant Human REC8 Protein Summary
| Description |
REC8 (Human) GST-Tagged Recombinant Protein
Source: Wheat Germ (in vitro) Amino Acid Sequence: MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDM |
| Preparation Method |
in vitro wheat germ expression system
|
| Details of Functionality |
This protein is not active and should not be used for experiments requiring activity.
|
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
REC8
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human REC8 Protein
- Cohesin Rec8p
- cohesion rec8p
- HR21spB
- meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family
- meiotic recombination protein REC8 homolog
- meiotic recombination protein REC8-like 1
- MGC950
- REC8 homolog (yeast)
- REC8L1human homolog of rad21, S. pombe
- REC8-like 1 (yeast)
- REC8-like 1
- Rec8p
- recombination and sister chromatid cohesion protein homolog
Background
This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]
