Product: Dicloxacillin (Sodium hydrate)
Recombinant Human HLA DQA1 Protein Summary
| Description |
HLA DQA1 (Human) GST-Tagged Recombinant Protein
Source: Wheat Germ (in vitro) Amino Acid Sequence: EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN |
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
HLA-DQA1
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human HLA DQA1 Protein
- CD
- CELIAC1DQ alpha 1 chain
- DC-1 alpha chain
- DQ-A1
- FLJ27088
- FLJ27328
- GSE
- HLA class II histocompatibility antigen, DQ(W3) alpha chain
- HLA-DCA
- HLA-DQA
- leucocyte antigen DQA1
- leukocyte antigen alpha chain
- major histocompatibility complex, class II, DQ alpha 1
- MGC149527
- MHC class II antigen
- MHC class II DQA1
- MHC class II HLA-D alpha glycoprotein
- MHC class II HLA-DQ-alpha-1
- MHC class II surface glycoprotein
- MHC HLA-DQ alpha
Background
HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq]
